PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_02075A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 294aa    MW: 30999.6 Da    PI: 6.5211
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_02075AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.34e-091562245
                               SSS-HHHHHHHHHHHHHTTTT.....-HHHHHHHHTTTS-HHHHHHHHH CS
            Myb_DNA-binding  2 grWTteEdellvdavkqlGgg.....tWktIartmgkgRtlkqcksrwq 45
                               g WT e ++ + +av+   g+      W++Ia+ +  g+t+++++ ++ 
  Oropetium_20150105_02075A 15 GTWTREQEKAFENAVATVVGDeegdaMWEKIAKLVE-GKTAEEVRQHYE 62
                               78****************999***************.**********95 PP

2Myb_DNA-binding39.81e-12125169347
                                SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                +WT++E+ l++ + +++G+g+W++I+r +   Rt+ q+ s+ qky
  Oropetium_20150105_02075A 125 AWTEDEHRLFLLGLEKYGKGDWRSISRNFVISRTPTQVASHAQKY 169
                                6*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129310.6151269IPR017884SANT domain
SMARTSM007171.5E-41367IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-51562IPR009057Homeodomain-like
PfamPF002497.1E-71562IPR001005SANT/Myb domain
CDDcd001674.03E-71665No hitNo description
SuperFamilySSF466891.0E-81771IPR009057Homeodomain-like
PROSITE profilePS5129416.605118174IPR017930Myb domain
SuperFamilySSF466891.87E-16120175IPR009057Homeodomain-like
SMARTSM007179.3E-11122172IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.6E-17122172IPR006447Myb domain, plants
CDDcd001672.98E-10125170No hitNo description
Gene3DG3DSA:1.10.10.609.4E-11125168IPR009057Homeodomain-like
PfamPF002493.3E-11125169IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MAVEEASSSG EEGAGTWTRE QEKAFENAVA TVVGDEEGDA MWEKIAKLVE GKTAEEVRQH  60
YELLVEDVDG IEAGRVPLPT YAGXXXXXXX XXXXXSGKKG SGGGGGHGDK GSAKSAEQER  120
RKGIAWTEDE HRLFLLGLEK YGKGDWRSIS RNFVISRTPT QVASHAQKYF IRLNSMNRER  180
RRSSIHDITS VNNGDASAAQ GPITGTNGQV TNPGKSSKQT PTAANTPPGV DAYGTTIGQP  240
VGGPLVSAVG TPVPTPPHMT YGMHAPVPGA VVPGAPVNMA PMPYPMPPPP SHG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-1417811173RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448771.11e-150hypothetical protein SORBIDRAFT_06g032880
SwissprotQ8S9H74e-56DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLC5YAI21e-150C5YAI2_SORBI; Putative uncharacterized protein Sb06g032880
STRINGSb06g032880.11e-149(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63763854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-81MYB family protein